Skip to content
Snippets Groups Projects

Repository graph

You can move around the graph by using the arrow keys.
Select Git revision
  • 6d452194ef21c3dec0fe3ff3742aaeb145c7b22f
  • main default protected
2 results
Created with Raphaël 2.2.014Jan9Dec7630Nov1098542126Octlast commit on this trashmainmainimplemented task 2 completlyfsfadfsafsadfasgfedastask 2 enhancementsremoved checksum checkfixed testsmoved crc to cpMsgimplemented receive parserfurther implementationadded further implementationadded CPCommandMSG and partially implemented send and receivemodified sequence diagramminor changes on sequence diagamadded sequence diagramminit project 2del projectinit commit
Loading